CXCL12a

Recombinant ID:

1818

Request Datasheet

Gene of Interest

Gene Synonyms:

CXCL12;SDF1;SDF1A;SDF1B

Protein Names:

Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]

Accession Data

Organism:

Homo sapiens (Human)

Mass (kDa):

10666

Length (aa):

93

Sequence:

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Proteomics (Proteome ID):

Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]

Proteomics (Chromosome):

UP000005640

Mass Spectrometry:

Mass=7959; Method=Electrospray; Range=22-89 (P48061-2); Evidence={ECO:0000269|PubMed:14525775}; Mass=7606; Method=Electrospray; Range=24-88 (P48061-2); Evidence={ECO:0000269|PubMed:14525775}; Mass=8522; Method=Electrospray; Range=22-93 (P48061-1); Evidence={ECO:0000269|PubMed:14525775}; Mass=8297; Method=Electrospray; Range=24-93 (P48061-1); Evidence={ECO:0000269|PubMed:14525775};

Function [CC]:

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner (PubMed:29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity). {ECO:0000250|UniProtKB:P40224, ECO:0000269|PubMed:11069075, ECO:0000269|PubMed:11859124, ECO:0000269|PubMed:16107333, ECO:0000269|PubMed:18802065, ECO:0000269|PubMed:19255243, ECO:0000269|PubMed:29301984, ECO:0000269|PubMed:8752281}.

Metal Binding:

N/A

Site:

SITE 45 45 Important for integrin interaction and activation. {ECO:0000269|PubMed:29301984}.; SITE 46 46 Important for dimer formation.; SITE 48 48 Important for integrin interaction and activation. {ECO:0000269|PubMed:29301984}.; SITE 64 64 Important for integrin interaction and activation. {ECO:0000269|PubMed:29301984}.

Tissue Specificity:

Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen. {ECO:0000269|PubMed:16626895}.

Disease:

N/A

Mutagenesis:

MUTAGEN 22 23 Missing: Abolished CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:9384579}.; MUTAGEN 22 22 K->A: Loss of chemotactic activity. {ECO:0000269|PubMed:17357154, ECO:0000269|PubMed:9384579}.; MUTAGEN 22 22 K->R: Abolished CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:17357154, ECO:0000269|PubMed:9384579}.; MUTAGEN 22 22 Missing: Abolished CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:17357154, ECO:0000269|PubMed:9384579}.; MUTAGEN 23 23 P->G: Abolished CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:9384579}.; MUTAGEN 25 27 SLS->AQA: Significantly impaired CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:9384579}.; MUTAGEN 28 28 Y->A: Impaired CXCR4 activation ability, but only slightly impaired binding to the receptor. {ECO:0000269|PubMed:9384579}.; MUTAGEN 28 28 Y->H: No significant effect on CXCR4 binding or activation. {ECO:0000269|PubMed:9384579}.; MUTAGEN 29 29 R->K: Slightly impaired binding and activation of CXCR4. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:9384579}.; MUTAGEN 29 29 R->Q: Greatly impaired chemotactic activity and enhanced inhibition by heparin. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:9384579}.; MUTAGEN 33 38 RFFESH->AAAAAA: Significantly decreased chemotactic activity. {ECO:0000269|PubMed:10954912}.; MUTAGEN 33 33 R->A: Significantly decreased anti-HIV-1 and chemotactic activities. {ECO:0000269|PubMed:10954912, ECO:0000269|PubMed:17264079}.; MUTAGEN 33 33 R->Q: Slightly impaired chemotactic activity and enhanced inhibition by heparin. Greatly impaired chemotactic activity; when associated with Q-29. {ECO:0000269|PubMed:10954912, ECO:0000269|PubMed:17264079}.; MUTAGEN 34 34 F->A: No effect on anti-HIV-1 and chemotactic activities. Slightly impaired chemotactic activity and no effect on inhibition by heparin; when associated with A-35. {ECO:0000269|PubMed:10954912}.; MUTAGEN 35 35 F->A: No effect on anti-HIV-1 and chemotactic activities. Slightly impaired chemotactic activity and no effect on inhibition by heparin; when associated with A-34. {ECO:0000269|PubMed:10954912}.; MUTAGEN 36 38 ESH->QSN: Slightly impaired chemotactic activity, no effect on inhibition by heparin. {ECO:0000269|PubMed:17264079}.; MUTAGEN 36 36 E->A: No effect on anti-HIV-1 and chemotactic activities. {ECO:0000269|PubMed:10954912}.; MUTAGEN 37 37 S->A: No effect on anti-HIV-1 and chemotactic activities. {ECO:0000269|PubMed:10954912}.; MUTAGEN 38 38 H->A: No effect on anti-HIV-1 and chemotactic activities. {ECO:0000269|PubMed:10954912}.; MUTAGEN 41 41 R->A: No effect on CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 45 48 KHLK->SSLS: Loss of heparin-binding capacity. {ECO:0000269|PubMed:10446158}.; MUTAGEN 45 45 K->E: Loss of integrin activation; when associated with E-48 or E-64. {ECO:0000269|PubMed:29301984}.; MUTAGEN 46 46 H->A: Reduced dimerization in neutral pH. Eliminates the pH dependence of dimerization. {ECO:0000269|PubMed:15741341, ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 46 46 H->L: No significant effect on dimerization in neutral pH. Eliminates the pH dependence of dimerization. {ECO:0000269|PubMed:15741341, ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 46 46 H->N: Slightly impaired CXCR4 activation and clear resistance to inhibition by heparin; when associated with Q-48; Q-62; Q-68 and N-69. {ECO:0000269|PubMed:15741341, ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 46 46 H->R: No effect on CXCR4 activation. Impaired dimer formation, leading to increased chemotactic activity. Eliminates the pH dependence of dimerization. {ECO:0000269|PubMed:15741341, ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 48 48 K->A: Impaired CXCR4 activation. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 48 48 K->E: Impaired CXCR4 activation. Loss of integrin activation; when associated with E-45 or E-64. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424, ECO:0000269|PubMed:29301984}.; MUTAGEN 48 48 K->Q: Slightly impaired CXCR4 activation and clear resistance to inhibition by heparin; when associated with N-46; Q-62; Q-68 and N-69. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 52 56 TPNCA->GPGCG: Slightly impaired chemotactic activity, no effect on inhibition by heparin. {ECO:0000269|PubMed:17264079}.; MUTAGEN 57 57 L->C: Formation of an intermolecular disulfide bond, leading to a locked dimer; when associated with C-86. No effect on CXCR4 activation, but loss of chemotactic activity; when associated with C-86.; MUTAGEN 60 60 V->A: Impaired CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 62 62 R->A: No effect on CXCR4 activation. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 62 62 R->Q: Slightly impaired CXCR4 activation and clear resistance to inhibition by heparin; when associated with N-46; Q-48; Q-68 and N-69. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 64 64 K->E: Loss of integrin activation; when associated with E-45 or E-48. {ECO:0000269|PubMed:29301984}.; MUTAGEN 68 68 R->A: Impaired CXCR4 activation. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 68 68 R->E: Greatly impaired CXCR4 activation. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 68 68 R->Q: Slightly impaired CXCR4 activation and clear resistance to inhibition by heparin; when associated with N-46; Q-48; Q-62 and N-69. {ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424}.; MUTAGEN 69 69 Q->N: Slightly impaired CXCR4 activation and clear resistance to inhibition by heparin; when associated with N-46; Q-48; Q-62 and Q-68. {ECO:0000269|PubMed:17264079}.; MUTAGEN 70 70 V->A: Impaired CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 81 81 E->A: No effect on CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 84 84 E->A: No effect on CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 85 85 K->A: No effect on CXCR4 activation. {ECO:0000269|PubMed:18799424}.; MUTAGEN 86 86 A->C: Formation of an intermolecular disulfide bond, leading to a locked dimer; when associated with C-57. No effect on CXCR4 activation, but loss of chemotactic activity; when associated with C-57.

Reagent Data

Name:

Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]

Class:

Subcategory:

Recombinant

Molecular Weight:

Source:

Species:

Human

Amino Acid Sequence:

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK

Tag:

Format:

Lyophilized

Formulation:

Inquire

Formulation Concentration:

Inquire

Buffer Volume:

Standard

Buffer Solution:

PBS

pH:

7.4-7.5

Stabilizers

NaCl:

Null

Metal Chelating Agents

EDTA:

Null

Purity:

> 97%

Determined:

SDS-PAGE

Stained:

Calcium Flux Assay

Validated:

Inquire

Sample Handling

Storage:

-20°C

Stability:

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Preparation:

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.