CTLA-4
Recombinant ID:
3780
Request Datasheet
Gene of Interest
Gene Synonyms:
Protein Names:
Accession Data
Organism:
Mus musculus (Mouse)
Mass (kDa):
24993
Length (aa):
223
Sequence:
MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Proteomics (Proteome ID):
Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152)
Proteomics (Chromosome):
UP000000589
Mass Spectrometry:
N/A
Function [CC]:
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. {ECO:0000250|UniProtKB:P16410}.
Metal Binding:
N/A
Site:
N/A
Tissue Specificity:
Widely expressed with highest levels in lymphoid tissues. {ECO:0000269|PubMed:10493833}.
Disease:
N/A
Mutagenesis:
N/A
Reagent Data
Name:
Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152)
Class:
Subcategory:
Recombinant
Molecular Weight:
Source:
Species:
Mouse
Amino Acid Sequence:
Tag:
Format:
Lyophilized
Formulation:
Sterile-filtered colorless solution
Formulation Concentration:
1mg/ml
Buffer Volume:
Standard
Buffer Solution:
PBS
pH:
7.4-7.5
Stabilizers
NaCl:
Null
Metal Chelating Agents
EDTA:
Null
Purity:
> 98%
Determined:
SDS-PAGE
Stained:
Inquire
Validated:
RP-HPLC
Sample Handling
Storage:
-20°C
Stability:
This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:
Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.









