ADIPOQ;ACDC;ACRP30;APM1;GBP28

Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)

Homo sapiens (Human)

26414

244

N/A

Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)

Adiponectin deficiency (ADPND) [MIM:612556]: A condition that results in very low concentrations of plasma adiponectin. {ECO:0000269|PubMed:10918532}. Note=The disease is caused by mutations affecting the gene represented in this entry.; Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

MUTAGEN 20 20 T->A: No change in sialylated isoforms. {ECO:0000269|PubMed:19855092}.; MUTAGEN 21 21 T->A: Some loss of sialylated isoforms. {ECO:0000269|PubMed:19855092}.; MUTAGEN 22 22 T->A: Abolishes sialylated isoforms. {ECO:0000269|PubMed:19855092}.; MUTAGEN 33 33 K->R: No effect on formation of HMW multimers. {ECO:0000269|PubMed:16497731}.; MUTAGEN 36 36 C->S: Impaired formation of MMW and HMW multimers. {ECO:0000269|PubMed:12878598, ECO:0000269|PubMed:16497731}.; MUTAGEN 65 65 K->R: Impaired formation of HMW multimers; when associated with R-68. {ECO:0000269|PubMed:16497731}.; MUTAGEN 68 68 K->R: Impaired formation of HMW multimers; when associated with R-65. {ECO:0000269|PubMed:16497731}.; MUTAGEN 77 77 K->R: Impaired formation of HMW multimers; when associated with R-101. {ECO:0000269|PubMed:16497731}.; MUTAGEN 101 101 K->R: Impaired formation of HMW multimers; when associated with R-77. {ECO:0000269|PubMed:16497731}.

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. {ECO:0000269|PubMed:11479627}.

Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.