CD9;MIC3;TSPAN29;GIG2

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Homo sapiens (Human)

25416

228

Pending Verification

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

N/A

MUTAGEN 9 9 C->A: Loss of palmitoylation; when associated with A-78; A-79; A-87; A-218 and A-219. {ECO:0000269|PubMed:11959120}.; MUTAGEN 78 78 C->A: Loss of palmitoylation; when associated with A-9; A-79; A-87; A-218 and A-219. {ECO:0000269|PubMed:11959120}.; MUTAGEN 79 79 C->A: Loss of palmitoylation; when associated with A-9; A-78; A-87; A-218 and A-219. {ECO:0000269|PubMed:11959120}.; MUTAGEN 87 87 C->A: Loss of palmitoylation; when associated with A-9; A-78; A-79; A-218 and A-219. {ECO:0000269|PubMed:11959120}.; MUTAGEN 218 218 C->A: Loss of palmitoylation; when associated with A-9; A-78; A-79; A-87 and A-219. {ECO:0000269|PubMed:11959120}.; MUTAGEN 219 219 C->A: Loss of palmitoylation; when associated with A-9; A-78; A-79; A-87 and A-218. {ECO:0000269|PubMed:11959120}.

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (PubMed:8478605, PubMed:14575715, PubMed:18541721). Present at the cell surface of oocytes and plays a key role in sperm-egg fusion, possibly by organizing multiprotein complexes and the morphology of the membrane required for the fusion (By similarity). In myoblasts, associates with CD81 and PTGFRN and inhibits myotube fusion during muscle regeneration (By similarity). In macrophages, associates with CD81 and beta-1 and beta-2 integrins, and prevents macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles (PubMed:12796480). Also prevents the fusion between mononuclear cell progenitors into osteoclasts in charge of bone resorption (By similarity). Acts as a receptor for PSG17 (By similarity). Involved in platelet activation and aggregation (PubMed:18541721). Regulates paranodal junction formation (By similarity). Involved in cell adhesion, cell motility and tumor metastasis (PubMed:8478605, PubMed:7511626). {ECO:0000250|UniProtKB:P40240, ECO:0000269|PubMed:12796480, ECO:0000269|PubMed:14575715, ECO:0000269|PubMed:18541721, ECO:0000269|PubMed:7511626, ECO:0000269|PubMed:8478605}.

Chain (1); Disulfide bond (2); Glycosylation (2); Initiator methionine (1); Lipidation (6); Mutagenesis (6); Sequence conflict (1); Topological domain (5); Transmembrane (4); Detected in platelets (at protein level) (PubMed:19640571). Expressed by a variety of hematopoietic and epithelial cells (PubMed:19640571). {ECO:0000269|PubMed:19640571}.

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.