CTXB
Vibrio cholerae serotype O1 Recombinant ctxB - His Tagged
Reference ID:KB-3882
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:ctxB;toxB;VC_1456
Protein Names:Cholera enterotoxin subunit B (Cholera enterotoxin B chain) (Cholera enterotoxin gamma chain) (Choleragenoid)
Accession Data
Organism:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Mass (kDa):139.57
Length (aa):124
Sequence:MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Proteomics (Proteome ID):UP000000584
Proteomics (Chromosome): Chromosome 1
Function [CC]:The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.
Mutagenesis:MUTAGEN 78 78 H->A: Loss of toxicity.
Reagent Data
Name:CTXB
Class:Infectious
Subcategory:Antigen
Region:Thr 22 - Asn 124
Molecular Weight:13.5
Source:HEK293
Species:Vibrio cholerae serotype O1
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.