B18R
Vaccinia virus Recombinant VACWR200 - His Tagged
Reference ID:KB-3881
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:VACWR200;B18R
Protein Names:Soluble interferon alpha/beta receptor B18 (B18)
Accession Data
Organism:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Mass (kDa):407.32
Length (aa):351
Sequence:MTMKMMVHIYFVSLLLLLFHSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE
Proteomics (Proteome ID):UP000000344
Proteomics (Chromosome): Genome
Function [CC]:Counteracts the antiviral effects of host IFN-alpha/beta. Acts as a soluble IFN-alpha receptor and thus inhibits the interaction between host IFN-alpha and its receptor. {ECO:0000269|PubMed:19073732}.
Reagent Data
Name:B18R
Class:Infectious
Subcategory:Antigen
Region:His 20 - Glu 351
Molecular Weight:40.3
Source:HEK293
Species:Vaccinia virus
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.